PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.002G139800.1.p
Common NameSb02g012860, SORBIDRAFT_02g012860
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 321aa    MW: 34646.4 Da    PI: 7.2883
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.002G139800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.84e-161462148
                          TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                          +g+W++eEd +l++++++ G+g +W + +++ g++R++k+c++rw++yl
  Sobic.002G139800.1.p 14 KGPWSPEEDRKLKEYIHKNGTGgNWIALPHKAGLKRCGKSCRLRWLNYL 62
                          79*********************************************97 PP

2Myb_DNA-binding39.41.3e-1269111246
                           SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           g ++ +Ed ++ ++++  G++ W+ Ia+ ++ gRt++++k++w++
  Sobic.002G139800.1.p  69 GDFSDDEDRIICNLFTTIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                           679******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.688962IPR017930Myb domain
SuperFamilySSF466892.56E-2611109IPR009057Homeodomain-like
SMARTSM007171.8E-121364IPR001005SANT/Myb domain
PfamPF002491.5E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-231569IPR009057Homeodomain-like
CDDcd001671.07E-91662No hitNo description
PROSITE profilePS5129421.33963117IPR017930Myb domain
SMARTSM007175.0E-1167115IPR001005SANT/Myb domain
PfamPF002492.0E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2270118IPR009057Homeodomain-like
CDDcd001676.37E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MGRAPCCDKL SVKKGPWSPE EDRKLKEYIH KNGTGGNWIA LPHKAGLKRC GKSCRLRWLN  60
YLRPNIKHGD FSDDEDRIIC NLFTTIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLMHS  120
LQPYTTHNHH STTVPSAAAA VASPEAAPIM SLQHLSSHDY SHIYSSDGSY SSNNSMTSLL  180
SAAAGSLGLL LNGEQQATTC LDSGGGHGIY LQEPYATTIS SNVHGHGLSA ETFIFGGFQS  240
QEDHHHHKVL LLSGSGAANN QLDEQYNFAA SCCYDDEKAP PLLSLTGGAD GAGGTTSSFF  300
YDSTYNEHTA TATTTRAGAQ *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002459873.10.0hypothetical protein SORBIDRAFT_02g012860
TrEMBLC5X6P00.0C5X6P0_SORBI; Putative uncharacterized protein Sb02g012860
STRINGSb02g012860.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65790.12e-73myb domain protein 68